Résultats pour rel:lsabt.com
-
bilingualtherapies.com
Bilingual School Therapy, Speech Language Pathology Jobs, Staffing and Clinical Developmen
Bilingual Therapies provides bilingual school therapy professionals to schools in diverse communities across North America.
-
mindfulprofessionalcounseling.com
Counseling Schaumburg Psychotherapist - Mindful Professional Counseling - Private Therapy
Bilingual Japanese English therapy and counseling provided by Asako Hoichi, NCC, LCPC, Schaumburg, Illinois.
-
bilingual-slpservices.com
Arizona | SLP | Speech Language Therapy | Bilingual SLP Services
Speech Therapy, Special Education Consulting and Bilingual Speech Services
-
thenonverbalvoice.com
Angela Bigford, bilingual counselor in Boulder, CO; adults, children, couples; trauma, gri
bilingual family systems counseling for adults, children & couples; trauma, grief & loss, chronic pain; Play Therapy, EMDR for trauma, Psych-K belief habits work, Hakomi Experiential Therapy, Family Constellation work, and SandPlay
-
bilingualtherapybydesign.com
Bilingual Therapy by Design
Bilingual Therapy By Design helps children with disablities to enhance their speech.
-
libertyspeechassociates.com
Liberty Speech Associates LLC - Bilingual Speech and Language Therapy
Bilingual and Spanish speech and language therapy services in New Jersey. Services provided in your home or in a community location.
-
progresslp.com
Progress SLP - Progress Bilingual Speech and Language Therapy
Progress provides Bilingual Speech and Language Therapy services in North Miami Beach, FL. Speech delay, fluency disorders, autism spectrum disorders, verbal apraxia, among others are treated.
-
speechjourneys.com
Bilingual Speech and Language Therapy-Speech Journeys LLC.
Offering bilingual English/Spanish speech and language therapy for children and adults, living in Dade and Broward County.
-
bilingualtherapy.net
Bilingual Therapy - Bilingual Speech Therapy Jobs, Bilingual Speech Pathology Jobs, Biling
Bilingual Therapy is a top provider for bilingual speech therapy jobs all over the country.
-
bilingualtherapybydesign.org
Bilingual Therapy by Design
Bilingual Therapy By Design helps children with disablities to enhance their speech.
-
bilingualspeechtherapist.com
Bilingual Speech Therapist | Bilingual Speech Therapy Resources for Speech Therapists &
Bilingual Speech Therapy Resources for Speech Therapists & Clients
@wordpressdotcom
-
communicationcare.com
CommunicationCare, PLLC | Durham, NC Bilingual Early-Intervention Speech Therapy
Karen Hensley M.Ed. CCC-SLP Bilingual Spanish Early-Intervention Speech Language Pathology Therapy Pathologist Therapist Durham NC Triangle Chapel Hill North Carolina CommunicationCare PLLC
-
couplescounselingofelpaso.com
Couples Counseling of El Paso • Anastacia Martinez, LPC, PC - Couples, marriage, divor
Couples, marriage, divorce, counseling, therapy, anger, stress, military, LGBT, bilingual, children, ADHD
-
physicaltherapykansas.com
Bilingual Physical Therapy Kansas City
Bilingual Physical Therapy Kansas City
-
bilingualslt.com
Bilingual Speech & Language Therapy - Speech Language Therapy, Infant Toddler Developm
Speech Language Therapy, Infant Toddler Developmental Specialist, Hearing Specialist
-
bilingualtherapyservices.com
Marketing for Therapists - Domain Name BilingualTherapyServices.com - Bilingual Therapy Se
Guide to marketing for therapists with special discount offers to all of the major therapist directories.
-
elitespeechtherapy.com
Elite Speech Therapy | Scott Wayne Ryerson - Bilingual Speech Language Pathologist New Jer
Specializing in:Comprehensive Evaluation and TherapyChallenging and Severe DisordersChildren and Adults with Special NeedsMulti-Symptom Diagno
-
infocuswellness.com
In Focus Wellness: Portland | Bilingual Bicultural Family Therapy | Dimensional Realignme
Holistic health approach to regain your emotional balance, connection and empowerment. Transformational healing, Dimensional Realignment®, family therapy.
-
livingwellfamilyandchildinstitute.com
Bilingual Counseling, Psychiatric Therapy, Counseling
Clara Aragón-Delk provides counseling services in Bilingual: English or Spanish Counseling Services, Services also include Family Evaluations and Counseling
